PDB entry 1j4w

View 1j4w on RCSB PDB site
Description: COMPLEX OF THE KH3 and KH4 DOMAINS OF FBP WITH A SINGLE_STRANDED 29mer DNA OLIGONUCLEOTIDE FROM THE FUSE ELEMENT OF THE C-MYC ONCOGENE
Class: transcription/DNA
Keywords: single-stranded DNA binding protein, transcription factor, fbp, fuse element, c-myc oncogene, transcription/DNA complex
Deposited on 2001-11-30, released 2002-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FUSE binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96AE4 (4-173)
      • cloning artifact (0-3)
      • engineered (58)
    Domains in SCOPe 2.08: d1j4wa1, d1j4wa2, d1j4wa3
  • Chain 'B':
    Compound: DNA (5'-d(*gp*tp*a*tp*ap*tp*tp*cp*cp*cp*tp*cp*gp*gp*g*ap*tp*tp*tp*tp*tp*tp*ap*tp*tp*tp*tp*gp*t)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j4wA (A:)
    gshmidvpiprfavgivigrngemikkiqndagvriqfkpddgttperiaqitgppdraq
    haaeiitdllrsvqagnpggpgpggrgrgrgqgnwnmgppgglqefnfivptgktgliig
    kggetiksisqqsgarielqrnpppnadpnmklftirgtpqqidyarqlieeki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4wA (A:)
    gshmidvpiprfavgivigrngemikkiqndagvriqfkpddgttperiaqitgppdraq
    haaeiitdllrsvqqefnfivptgktgliigkggetiksisqqsgarielqrnpppnadp
    nmklftirgtpqqidyarqlieeki
    

  • Chain 'B':
    No sequence available.