PDB entry 1j4u

View 1j4u on RCSB PDB site
Description: Structure of Artocarpin Complexed with Me-alpha-Mannose
Class: plant protein
Keywords: all Beta, Greek Key motif, Beta prism I fold, PLANT PROTEIN
Deposited on 2001-10-30, released 2002-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (0-148)
      • modified residue (0)
      • conflict (8)
      • conflict (19)
      • conflict (48)
      • conflict (69)
      • conflict (83)
      • conflict (144)
      • conflict (147)
    Domains in SCOPe 2.07: d1j4ua_
  • Chain 'B':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (0-148)
      • modified residue (0)
      • conflict (8)
      • conflict (19)
      • conflict (48)
      • conflict (69)
      • conflict (83)
      • conflict (144)
      • conflict (147)
    Domains in SCOPe 2.07: d1j4ub_
  • Chain 'C':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (0-148)
      • modified residue (0)
      • conflict (8)
      • conflict (19)
      • conflict (48)
      • conflict (69)
      • conflict (83)
      • conflict (144)
      • conflict (147)
    Domains in SCOPe 2.07: d1j4uc_
  • Chain 'D':
    Compound: Artocarpin
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1T4 (0-148)
      • modified residue (0)
      • conflict (8)
      • conflict (19)
      • conflict (48)
      • conflict (69)
      • conflict (83)
      • conflict (144)
      • conflict (147)
    Domains in SCOPe 2.07: d1j4ud_
  • Heterogens: MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4uA (A:)
    asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4uB (B:)
    asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4uC (C:)
    asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4uD (D:)
    asqtitvgswggpggngwdegsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
    pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
    nlpienglivgfkgrtgdlldaigihmsl