PDB entry 1j4l

View 1j4l on RCSB PDB site
Description: solution structure of the fha2 domain of rad53 complexed with a phosphothreonyl peptide derived from rad9
Class: transferase
Keywords: fha domain, rad53, rad9, phosphothreonine, phosphoprotein, transferase
Deposited on 2001-10-03, released 2001-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase spk1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SPK1 or Rad53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1j4la_
  • Chain 'P':
    Compound: DNA repair protein rad9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14737 (0-8)
      • modified residue (4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j4lA (A:)
gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl

  • Chain 'P':
    No sequence available.