PDB entry 1j4k

View 1j4k on RCSB PDB site
Description: solution structure of the fha2 domain of rad53 complexed with a phosphotyrosyl peptide derived from rad9
Deposited on 2001-10-03, released 2001-12-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1j4ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j4kA (A:)
gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl