PDB entry 1j4h

View 1j4h on RCSB PDB site
Description: crystal structure analysis of the FKBP12 complexed with 000107 small molecule
Class: isomerase
Keywords: Isomerase, Rotamase
Deposited on 2001-09-30, released 2003-06-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fkbp12
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
  Domains in SCOP 1.75: d1j4ha_
• Heterogens: SUB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j4hA (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle