PDB entry 1j4a

View 1j4a on RCSB PDB site
Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus
Class: oxidoreductase
Keywords: nad-dependent dehydrogenase, reversible interconversion of pyruvate into d-lactate, oxidoreductase
Deposited on 2001-08-18, released 2002-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus delbrueckii subsp. bulgaricus [TaxId:1585]
    Gene: LDHD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26297
      • see remark 999 (58)
      • see remark 999 (116)
      • see remark 999 (151)
      • engineered (296)
    Domains in SCOPe 2.08: d1j4aa1, d1j4aa2
  • Chain 'B':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus delbrueckii subsp. bulgaricus [TaxId:1585]
    Gene: LDHD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26297
      • see remark 999 (58)
      • see remark 999 (116)
      • see remark 999 (151)
      • engineered (296)
    Domains in SCOPe 2.08: d1j4ab1, d1j4ab2
  • Chain 'C':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus delbrueckii subsp. bulgaricus [TaxId:1585]
    Gene: LDHD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26297
      • see remark 999 (58)
      • see remark 999 (116)
      • see remark 999 (151)
      • engineered (296)
    Domains in SCOPe 2.08: d1j4ac1, d1j4ac2
  • Chain 'D':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus delbrueckii subsp. bulgaricus [TaxId:1585]
    Gene: LDHD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26297 (Start-332)
      • see remark 999 (58)
      • see remark 999 (116)
      • see remark 999 (151)
      • engineered (296)
    Domains in SCOPe 2.08: d1j4ad1, d1j4ad2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j4aA (A:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktaf
    ytthavrnmvvkafdnnlelvegkeaetpvkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4aA (A:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j4aB (B:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktaf
    ytthavrnmvvkafdnnlelvegkeaetpvkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4aB (B:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j4aC (C:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktaf
    ytthavrnmvvkafdnnlelvegkeaetpvkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4aC (C:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j4aD (D:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktaf
    ytthavrnmvvkafdnnlelvegkeaetpvkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4aD (D:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkvg