PDB entry 1j49

View 1j49 on RCSB PDB site
Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus
Class: oxidoreductase
Keywords: nad-dependent dehydrogenase, last step of glycolysis under anaerobic conditions, reversible interconversion of pyruvate into d-lactate, oxidoreductase
Deposited on 2001-08-14, released 2002-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus delbrueckii subsp. bulgaricus [TaxId:1585]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26297 (0-End)
      • see remark 999 (58)
      • see remark 999 (116)
      • see remark 999 (151)
    Domains in SCOPe 2.08: d1j49a1, d1j49a2
  • Chain 'B':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus delbrueckii subsp. bulgaricus [TaxId:1585]
    Gene: LDHA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26297 (0-End)
      • see remark 999 (58)
      • see remark 999 (116)
      • see remark 999 (151)
    Domains in SCOPe 2.08: d1j49b1, d1j49b2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j49A (A:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtphtaf
    ytthavrnmvvkafdnnlelvegkeaetpvkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j49A (A:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtphtaf
    ytthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j49B (B:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtphtaf
    ytthavrnmvvkafdnnlelvegkeaetpvkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j49B (B:)
    mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
    etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
    qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
    dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtphtaf
    ytthavrnmvvkafdnnlelvegkeaetpvkv