PDB entry 1j48

View 1j48 on RCSB PDB site
Description: Crystal Structure of Apo-C1027
Class: antibiotic
Keywords: Antibiotic, DNA-binding
Deposited on 2001-07-30, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoprotein of C1027
    Species: Streptomyces globisporus [TaxId:1908]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j48a_
  • Chain 'B':
    Compound: Apoprotein of C1027
    Species: Streptomyces globisporus [TaxId:1908]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j48b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j48A (A:)
    apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga
    asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j48A (A:)
    apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga
    asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j48B (B:)
    apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga
    asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j48B (B:)
    apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga
    asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltf