PDB entry 1j3x

View 1j3x on RCSB PDB site
Description: solution structure of the n-terminal domain of the hmgb2
Deposited on 2003-02-19, released 2004-06-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1j3xa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j3xA (A:)
  mgkgdpnkprgkmssyaffvqtsreehkkkhpdssvnfaefskkcserwktmsakekskf
  edmaksdkarydremkn