PDB entry 1j3x

View 1j3x on RCSB PDB site
Description: Solution structure of the N-terminal domain of the HMGB2
Class: DNA binding protein
Keywords: hmg-box, DNA binding protein
Deposited on 2003-02-19, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: High mobility group protein 2
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17741 (0-76)
    • engineered (22)
  Domains in SCOPe 2.08: d1j3xa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j3xA (A:)
  mgkgdpnkprgkmssyaffvqtsreehkkkhpdssvnfaefskkcserwktmsakekskf
  edmaksdkarydremkn