PDB entry 1j3u

View 1j3u on RCSB PDB site
Description: Crystal structure of aspartase from Bacillus sp. YM55-1
Class: lyase
Keywords: multi-domains, lyase
Deposited on 2003-02-16, released 2003-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartase
    Species: Bacillus sp. YM55-1 [TaxId:96471]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCC6
      • conflict (459)
    Domains in SCOPe 2.07: d1j3ua_
  • Chain 'B':
    Compound: aspartase
    Species: Bacillus sp. YM55-1 [TaxId:96471]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCC6
      • conflict (459)
    Domains in SCOPe 2.07: d1j3ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3uA (A:)
    mntdvriekdflgekeipkdayygvqtiratenfpitgyrihpelikslgivkksaalan
    mevglldkevgqyivkaadeviegkwndqfivdpiqggagtsinmnanevianralelmg
    eekgnyskispnshvnmsqstndafptathiavlsllnqliettkymqqefmkkadefag
    vikmgrthlqdavpillgqefeayarviardieriantrnnlydinmgatavgtglnadp
    eyisivtehlakfsghplrsaqhlvdatqntdcytevssalkvcminmskiandlrlmas
    gpraglseivlparqpgssimpgkvnpvmpevmnqvafqvfgndltitsaseagqfelnv
    mepvlffnliqsisimtnvfksftenclkgikaneermkeyveksigiitainphvgyet
    aaklareayltgesirelcikygvlteeqlneilnpyemihpgiagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3uA (A:)
    vriekdflgekeipkdayygvqtiratenfpitgyrihpelikslgivkksaalanmevg
    lldkevgqyivkaadeviegkwndqfivdpiqggagtsinmnanevianralelmgeekg
    nyskispnshvnmsqstndafptathiavlsllnqliettkymqqefmkkadefagvikm
    grthlqdavpillgqefeayarviardieriantrnnlydinmgatavgtglnadpeyis
    ivtehlakfsghplrsaqhlvdatqntdcytevssalkvcminmskiandlrlmasgpra
    glseivlparqpgssimpgkvnpvmpevmnqvafqvfgndltitsaseagqfelnvmepv
    lffnliqsisimtnvfksftenclkgikaneermkeyveksigiitainphvgyetaakl
    areayltgesirelcikygvlteeqlneilnpyemihpgiag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3uB (B:)
    mntdvriekdflgekeipkdayygvqtiratenfpitgyrihpelikslgivkksaalan
    mevglldkevgqyivkaadeviegkwndqfivdpiqggagtsinmnanevianralelmg
    eekgnyskispnshvnmsqstndafptathiavlsllnqliettkymqqefmkkadefag
    vikmgrthlqdavpillgqefeayarviardieriantrnnlydinmgatavgtglnadp
    eyisivtehlakfsghplrsaqhlvdatqntdcytevssalkvcminmskiandlrlmas
    gpraglseivlparqpgssimpgkvnpvmpevmnqvafqvfgndltitsaseagqfelnv
    mepvlffnliqsisimtnvfksftenclkgikaneermkeyveksigiitainphvgyet
    aaklareayltgesirelcikygvlteeqlneilnpyemihpgiagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3uB (B:)
    vriekdflgekeipkdayygvqtiratenfpitgyrihpelikslgivkksaalanmevg
    lldkevgqyivkaadeviegkwndqfivdpiqggagtsinmnanevianralelmgeekg
    nyskispnshvnmsqstndafptathiavlsllnqliettkymqqefmkkadefagvikm
    grthlqdavpillgqefeayarviardieriantrnnlydinmgatavgtglnadpeyis
    ivtehlakfsghplrsaqhlvdatqntdcytevssalkvcminmskiandlrlmasgpra
    glseivlparqpgssimpgkvnpvmpevmnqvafqvfgndltitsaseagqfelnvmepv
    lffnliqsisimtnvfksftenclkgikaneermkeyveksigiitainphvgyetaakl
    areayltgesirelcikygvlteeqlneilnpyemihpgiag