PDB entry 1j3t

View 1j3t on RCSB PDB site
Description: Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
Class: endocytosis/exocytosis
Keywords: BETA BARREL, SH3 DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2003-02-13, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intersectin 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hh15293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZM3 (7-67)
      • cloning artifact (0-6)
      • cloning artifact (68-73)
    Domains in SCOPe 2.07: d1j3ta1, d1j3ta2, d1j3ta3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3tA (A:)
    gssgssgvenlkaqalcswtakkdnhlnfskhdiitvleqqenwwfgevhggrgwfpksy
    vkiipgsesgpssg