PDB entry 1j3r

View 1j3r on RCSB PDB site
Description: Crystal structure of Thermococcus litoralis phosphogrucose isomerase complexed with gluconate-6-phosphate
Class: isomerase
Keywords: phosphoglucose isomerase, cupin superfamily, iron ion, archaea, gluconate 6-phosphate, ISOMERASE
Deposited on 2003-02-11, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucose isomerase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3ra_
  • Chain 'B':
    Compound: phosphoglucose isomerase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3rb_
  • Heterogens: 6PG, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3rA (A:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpkwrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3rA (A:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3rB (B:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpkwrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3rB (B:)
    ykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieqee
    kegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearfie
    mepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkvvv
    kdnpk