PDB entry 1j3q

View 1j3q on RCSB PDB site
Description: Crystal structure of Thermococcus litoralis phosphogrucose isomerase soaked with FeSO4
Class: isomerase
Keywords: phosphoglucose isomerase, cupin superfamily, iron ion, archaea
Deposited on 2003-02-11, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.238
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucose isomerase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3qa_
  • Chain 'B':
    Compound: phosphoglucose isomerase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3qb_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3qA (A:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpkwrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3qA (A:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3qB (B:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpkwrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3qB (B:)
    ykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieqee
    kegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearfie
    mepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkvvv
    kdn