PDB entry 1j3p

View 1j3p on RCSB PDB site
Description: Crystal structure of Thermococcus litoralis phosphoglucose isomerase
Class: isomerase
Keywords: phosphoglucose isomerase, cupin superfamily, iron ion, archaea, ISOMERASE
Deposited on 2003-02-11, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucose isomerase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3pa_
  • Chain 'B':
    Compound: phosphoglucose isomerase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3pb_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3pA (A:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpkwrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3pA (A:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3pB (B:)
    mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
    eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
    iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
    vvkdnpkwrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3pB (B:)
    ykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieqee
    kegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearfie
    mepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkvvv
    kdn