PDB entry 1j3n

View 1j3n on RCSB PDB site
Description: Crystal Structure of 3-oxoacyl-(acyl-carrier protein) Synthase II from Thermus thermophilus HB8
Class: transferase
Keywords: Condensing Enzymes, Fatty acid elongation, Acyl-carrier protein (ACP), Beta-keto-ACP synthase (KAS), Homodimer, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-02-10, released 2003-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier protein) synthase II
    Species: Thermus thermophilus [TaxId:274]
    Gene: fabF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3na1, d1j3na2
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier protein) synthase II
    Species: Thermus thermophilus [TaxId:274]
    Gene: fabF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3nb1, d1j3nb2
  • Heterogens: MG, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3nA (A:)
    mrrvvvtglgaltpigvgqeafhkaqlagksgvrpitrfdasalpvriaaevdvdpgayl
    drkelrrldrfvqyaliaaqlaledaglkpedldpervgtlvgtgiggmetweaqsrvfl
    ergpnrispffipmmianmasahiamrygftgpsstvvtacatgadalgsalrmiqlgea
    dlvlaggteaaitpmaigafavmralstrneepekasrpftlsrdgfvmgegagvlvlea
    yehakkrgariyaelvgfgrsadahhitephpegkgaalamaralkdagiapeqvgyina
    hgtstpvgdraevlaikrvfgdhakrlmvsstksmighllgaagaveaiatvqalyhgvi
    pptinledpdpeldldfvpepreakvdyalsnsfafgghnavlafkrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3nB (B:)
    mrrvvvtglgaltpigvgqeafhkaqlagksgvrpitrfdasalpvriaaevdvdpgayl
    drkelrrldrfvqyaliaaqlaledaglkpedldpervgtlvgtgiggmetweaqsrvfl
    ergpnrispffipmmianmasahiamrygftgpsstvvtacatgadalgsalrmiqlgea
    dlvlaggteaaitpmaigafavmralstrneepekasrpftlsrdgfvmgegagvlvlea
    yehakkrgariyaelvgfgrsadahhitephpegkgaalamaralkdagiapeqvgyina
    hgtstpvgdraevlaikrvfgdhakrlmvsstksmighllgaagaveaiatvqalyhgvi
    pptinledpdpeldldfvpepreakvdyalsnsfafgghnavlafkrv