PDB entry 1j3m

View 1j3m on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein TT1751 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: X-ray crystallography, hypothetical, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-02-05, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: the conserved hypothetical protein TT1751
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3ma_
  • Chain 'B':
    Compound: the conserved hypothetical protein TT1751
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3mb_
  • Heterogens: SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3mA (A:)
    mtgmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpn
    laaralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeart
    rlsralsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3mA (A:)
    gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla
    aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl
    sralsrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3mB (B:)
    mtgmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpn
    laaralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeart
    rlsralsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3mB (B:)
    gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla
    aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl
    sralsrl