PDB entry 1j3m

View 1j3m on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein TT1751 from Thermus thermophilus HB8
Deposited on 2003-02-05, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1j3ma_
  • Chain 'B':
    Domains in SCOP 1.69: d1j3mb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3mA (A:)
    mtgmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpn
    laaralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeart
    rlsralsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3mA (A:)
    gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla
    aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl
    sralsrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3mB (B:)
    mtgmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpn
    laaralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeart
    rlsralsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3mB (B:)
    gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla
    aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl
    sralsrl