PDB entry 1j3l

View 1j3l on RCSB PDB site
Description: Structure of the RNA-processing inhibitor RraA from Thermus thermophilis
Deposited on 2003-02-04, released 2004-02-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j3la_
  • Chain 'B':
    Domains in SCOP 1.67: d1j3lb_
  • Chain 'C':
    Domains in SCOP 1.67: d1j3lc_
  • Chain 'D':
    Domains in SCOP 1.67: d1j3ld_
  • Chain 'E':
    Domains in SCOP 1.67: d1j3le_
  • Chain 'F':
    Domains in SCOP 1.67: d1j3lf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3lA (A:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3lB (B:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j3lC (C:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3lC (C:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3lD (D:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3lE (E:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j3lF (F:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3lF (F:)
    mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
    fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
    egkgevdvplkvlgvevlpgsflladedgllllpepp