PDB entry 1j3g

View 1j3g on RCSB PDB site
Description: Solution structure of Citrobacter Freundii AmpD
Class: hydrolase
Keywords: mixed alpha-beta
Deposited on 2003-01-31, released 2003-02-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AmpD protein
    Species: Citrobacter freundii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j3ga_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j3gA (A:)
mlldegwlaearrvpsphydcrpddenpsllvvhnislppgefggpwidalftgtidpna
hpyfagiahlrvsahclirrdgeivqyvpfdkrawhagvssyqgrercndfsigielegt
dtlaytdaqyqqlaavtnalitrypaiannmtghcniaperktdpgpsfdwarfralvtp
sshkemt