PDB entry 1j3e

View 1j3e on RCSB PDB site
Description: Crystal Structure of the E.coli SeqA protein complexed with N6-methyladenine- guanine mismatch DNA
Class: replication/DNA
Keywords: Protein-DNA complex, Recognition of hemimethylated DNA, mismatched DNA, replication, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, REPLICATION/DNA COMPLEX
Deposited on 2003-01-24, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (4-114)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1j3ea1, d1j3ea2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*gp*gp*(6ma)p*tp*cp*cp*ap*a)-3'
    Species:
    Gene:
  • Chain 'C':
    Compound: 5'-d(*tp*tp*gp*gp*ap*gp*cp*cp*tp*t)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3eA (A:)
    plgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeq
    tllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.