PDB entry 1j3d

View 1j3d on RCSB PDB site
Description: Solution structure of the C-terminal domain of the HMGB2
Class: DNA binding protein
Keywords: HMG-BOX, DNA binding protein
Deposited on 2003-01-23, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: High mobility group protein 2
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17741 (1-77)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d1j3da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j3dA (A:)
  mkkdpnapkrppsafflfcsehrpkiksehpglsigdtakklgemwseqsakdkqpyeqk
  aaklkekyekdiaayrak