PDB entry 1j3a

View 1j3a on RCSB PDB site
Description: Crystal structure of ribosomal protein L13 from Pyrococcus horikoshii
Deposited on 2003-01-21, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1j3aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3aA (A:)
    mriinadglilgrlasrvakmllegeevvivnaekavitgnrevifskykqrtglrtltn
    prrgpfypkrsdeivrrtirgmlpwktdrgrkafrrlkvyvgipkefqdkqletiveahv
    srlsrpkyvtvgevakflggkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3aA (A:)
    mriinadglilgrlasrvakmllegeevvivnaekavitgnrevifskykqrtypkrsde
    ivrrtirgmlpwktdrgrkafrrlkvyvgipkefqdkqletiveahvsrlsrpkyvtvge
    vakflggkf