PDB entry 1j39

View 1j39 on RCSB PDB site
Description: Crystal Structure of T4 phage BGT in complex with its UDP-glucose substrate
Class: transferase
Keywords: glycosyltransferase, GT-B, UDP-glucose, TRANSFERASE
Deposited on 2003-01-21, released 2003-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.194
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: BGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j39a_
  • Heterogens: UPG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j39A (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j39A (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinkpnlailsaqkfmakykskiyylftdirlpfsqswpnrpwaylyteeell
    ikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkktldviyg
    gsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipmnmvsekn
    sqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyvnnraeli
    drvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl