PDB entry 1j36

View 1j36 on RCSB PDB site
Description: Crystal Structure of Drosophila AnCE
Class: hydrolase/hydrolase inhibitor
Keywords: Angiotensin, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2003-01-20, released 2003-07-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin converting enzyme
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10714 (Start-601)
      • conflict (37)
      • conflict (39)
      • conflict (593)
      • expression tag (602-606)
    Domains in SCOPe 2.01: d1j36a_
  • Chain 'B':
    Compound: angiotensin converting enzyme
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10714 (Start-601)
      • conflict (37)
      • conflict (39)
      • conflict (593)
      • expression tag (602-606)
    Domains in SCOPe 2.01: d1j36b_
  • Heterogens: ZN, LPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j36A (A:)
    vtqalvkeeiqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfm
    kevasdttkfqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvc
    dykdstkcdlaldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaak
    lnnftsgaeawldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgp
    ipmhllgnmwaqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnlt
    klpqdfwdksiiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiq
    yflqyqhqpfvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfl
    taldkivflpfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdap
    akyhisadveylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafh
    nmlsmgaskpwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcv
    sshhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j36A (A:)
    iqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfmkevasdttk
    fqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdykdstkcd
    laldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnnftsgae
    awldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipmhllgnm
    waqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnltklpqdfwdk
    siiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiqyflqyqhqp
    fvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltaldkivfl
    pfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapakyhisadv
    eylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafhnmlsmgask
    pwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcvsshhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j36B (B:)
    vtqalvkeeiqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfm
    kevasdttkfqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvc
    dykdstkcdlaldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaak
    lnnftsgaeawldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgp
    ipmhllgnmwaqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnlt
    klpqdfwdksiiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiq
    yflqyqhqpfvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfl
    taldkivflpfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdap
    akyhisadveylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafh
    nmlsmgaskpwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcv
    sshhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j36B (B:)
    iqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfmkevasdttk
    fqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdykdstkcd
    laldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnnftsgae
    awldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipmhllgnm
    waqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnltklpqdfwdk
    siiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiqyflqyqhqp
    fvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltaldkivfl
    pfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapakyhisadv
    eylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafhnmlsmgask
    pwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcvsshhhhh