PDB entry 1j35

View 1j35 on RCSB PDB site
Description: Crystal Structure of Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein
Class: Protein binding/Blood clotting
Keywords: MAGNESIUM ION, CALCIUM ION, GLA DOMAIN, Protein binding/Blood clotting COMPLEX
Deposited on 2003-01-20, released 2003-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.227
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor IX-binding protein A chain
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j35a_
  • Chain 'B':
    Compound: coagulation factor IX-binding protein B chain
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j35b_
  • Chain 'C':
    Compound: coagulation factor ix
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00741 (0-45)
      • modified residue (6-7)
      • modified residue (14)
      • modified residue (16)
      • modified residue (19-20)
      • modified residue (25-26)
      • modified residue (29)
      • modified residue (32)
      • modified residue (35)
      • modified residue (39)
    Domains in SCOPe 2.08: d1j35c_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j35A (A:)
    dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
    ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
    qqnpfvcea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j35B (B:)
    dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
    hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
    fqa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j35C (C:)
    ynsgkleefvrgnlereckeekcsfeearevfentekttefwkqyv