PDB entry 1j34
View 1j34 on RCSB PDB site
Description: Crystal Structure of Mg(II)-and Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein
Class: Protein binding/Blood clotting
Keywords: MAGNESIUM ION, CALCIUM ION, GLA DOMAIN, Protein binding/Blood clotting COMPLEX
Deposited on
2003-01-20, released
2003-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.183
AEROSPACI score: 0.6
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: coagulation factor IX-binding protein A chain
Species: Trimeresurus flavoviridis [TaxId:88087]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1j34a_ - Chain 'B':
Compound: coagulation factor IX-binding protein B chain
Species: Trimeresurus flavoviridis [TaxId:88087]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1j34b_ - Chain 'C':
Compound: coagulation factor ix
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00741 (0-45)
- modified residue (6-7)
- modified residue (14)
- modified residue (16)
- modified residue (19-20)
- modified residue (25-26)
- modified residue (29)
- modified residue (32)
- modified residue (35)
- modified residue (39)
Domains in SCOPe 2.06: d1j34c_ - Heterogens: MG, CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1j34A (A:)
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1j34B (B:)
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1j34C (C:)
ynsgkleefvrgnlereckeekcsfeearevfentekttefwkqyv