PDB entry 1j33

View 1j33 on RCSB PDB site
Description: Crystal structure of CobT from Thermus thermophilus HB8
Class: transferase
Keywords: PHOSPHORIBOSYLTRANSFERASE, COBALAMIN BIOSYNTHESIS, VITAMIN B12, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2003-01-17, released 2003-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CobT
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j33a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j33A (A:)
    mvpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
    egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
    gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
    lppeavvgrgtgvgeeglrrkrqavaralarlhpgmgplevaaevggielvaiagiyleg
    yeaglplvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldl
    algegtgavlampllraaarilhmatfqeagvsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j33A (A:)
    pevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvvaeg
    vsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrpgt
    anlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallglp
    peavvgrgtgvgeeglrrkrqavaralarlhpgmgplevaaevggielvaiagiylegye
    aglplvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldlal
    gegtgavlampllraaarilhmatfqeagvsrg