PDB entry 1j31

View 1j31 on RCSB PDB site
Description: Crystal Structure of Hypothetical Protein PH0642 from Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: alpha-beta-beta-alpha sandwich, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2003-01-16, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PH0642
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (0-261)
      • modified residue (0)
      • modified residue (8)
      • modified residue (72)
      • modified residue (143)
      • modified residue (173)
      • modified residue (180)
      • modified residue (247)
    Domains in SCOPe 2.08: d1j31a_
  • Chain 'B':
    Compound: Hypothetical protein PH0642
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (0-261)
      • modified residue (0)
      • modified residue (8)
      • modified residue (72)
      • modified residue (143)
      • modified residue (173)
      • modified residue (180)
      • modified residue (247)
    Domains in SCOPe 2.08: d1j31b_
  • Chain 'C':
    Compound: Hypothetical protein PH0642
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (0-261)
      • modified residue (0)
      • modified residue (8)
      • modified residue (72)
      • modified residue (143)
      • modified residue (173)
      • modified residue (180)
      • modified residue (247)
    Domains in SCOPe 2.08: d1j31c_
  • Chain 'D':
    Compound: Hypothetical protein PH0642
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (0-261)
      • modified residue (0)
      • modified residue (8)
      • modified residue (72)
      • modified residue (143)
      • modified residue (173)
      • modified residue (180)
      • modified residue (247)
    Domains in SCOPe 2.08: d1j31d_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j31A (A:)
    mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
    qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
    kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
    mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
    rnkrlndmndifkdrreeyyfr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j31B (B:)
    mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
    qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
    kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
    mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
    rnkrlndmndifkdrreeyyfr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j31C (C:)
    mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
    qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
    kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
    mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
    rnkrlndmndifkdrreeyyfr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j31D (D:)
    mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
    qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
    kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
    mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
    rnkrlndmndifkdrreeyyfr