PDB entry 1j2z

View 1j2z on RCSB PDB site
Description: crystal structure of udp-n-acetylglucosamine acyltransferase
Deposited on 2003-01-15, released 2004-01-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1j2za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2zA (A:)
    mskiaktaiispkaeinkgveigefcvigdgvkldegvklhnnvtlqghtfvgknteifp
    favlgtqpqdlkykgeyseliigednlirefcminpgteggikktligdknllmayvhva
    hdcvigshcilangvtlaghieigdyvniggltaihqfvriakgcmiagksalgkdvppy
    ctvegnrafirglnrhrmrqlleskdidfiyalykrlfrpipslresakleleehannpf
    vkeicsfilessrgvayksseysseekqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2zA (A:)
    skiaktaiispkaeinkgveigefcvigdgvkldegvklhnnvtlqghtfvgknteifpf
    avlgtqpqdlkykgeyseliigednlirefcminpgteggikktligdknllmayvhvah
    dcvigshcilangvtlaghieigdyvniggltaihqfvriakgcmiagksalgkdvppyc
    tvegnrafirglnrhrmrqlleskdidfiyalykrlfrpipslresakleleehannpfv
    keicsfilessrgvaykss