PDB entry 1j2w

View 1j2w on RCSB PDB site
Description: Tetrameric Structure of aldolase from Thermus thermophilus HB8
Class: lyase
Keywords: Schiff base, deoxyribose phospahte, carbinolamine, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, lyase
Deposited on 2003-01-14, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2wa_
  • Chain 'B':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2wb_
  • Chain 'C':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2wc_
  • Chain 'D':
    Compound: Aldolase protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2wA (A:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2wA (A:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2wB (B:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2wB (B:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j2wC (C:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2wC (C:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j2wD (D:)
    mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
    vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
    lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
    aaggirdretalrmlkagasrlgtssgvalvageggtlgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2wD (D:)
    dlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtvv
    gfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqavl
    kviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvka
    aggirdretalrmlkagasrlgtssgvalv