PDB entry 1j2v

View 1j2v on RCSB PDB site
Description: crystal structure of cuta1 from pyrococcus horikoshii
Deposited on 2003-01-11, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1j2va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j2vA (A:)
  miivyttfpdwesaekvvktllkermiacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk