PDB entry 1j2r

View 1j2r on RCSB PDB site
Description: crystal structure of escherichia coli gene product yecd at 1.3 a resolution
Deposited on 2003-01-09, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.146
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j2ra_
  • Chain 'B':
    Domains in SCOP 1.67: d1j2rb_
  • Chain 'C':
    Domains in SCOP 1.67: d1j2rc_
  • Chain 'D':
    Domains in SCOP 1.67: d1j2rd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2rA (A:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rA (A:)
    mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsa
    dyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrg
    idtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrs
    veeilnal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2rB (B:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rB (B:)
    lnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsadya
    ealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgidt
    ivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsvee
    ilnal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j2rC (C:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rC (C:)
    lelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsad
    yaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgi
    dtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsv
    eeilnal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j2rD (D:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rD (D:)
    mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsa
    dyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrg
    idtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrs
    veeilnal