PDB entry 1j2r

View 1j2r on RCSB PDB site
Description: Crystal structure of Escherichia coli gene product Yecd at 1.3 A resolution
Class: Structural genomics, unknown function
Keywords: parallel beta-sheet 3-2-1-4-5-6, alpha-beta-alpha motif, tetramere, structural genomics, Bacterial targets at IGS-CNRS, France, BIGS, unknown function
Deposited on 2003-01-09, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical isochorismatase family protein yecD
    Species: Escherichia coli [TaxId:562]
    Gene: yecD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37347 (Start-198)
      • engineered (102)
    Domains in SCOPe 2.08: d1j2ra_
  • Chain 'B':
    Compound: Hypothetical isochorismatase family protein yecD
    Species: Escherichia coli [TaxId:562]
    Gene: yecD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37347 (Start-198)
      • engineered (102)
    Domains in SCOPe 2.08: d1j2rb_
  • Chain 'C':
    Compound: Hypothetical isochorismatase family protein yecD
    Species: Escherichia coli [TaxId:562]
    Gene: yecD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37347 (Start-198)
      • engineered (102)
    Domains in SCOPe 2.08: d1j2rc_
  • Chain 'D':
    Compound: Hypothetical isochorismatase family protein yecD
    Species: Escherichia coli [TaxId:562]
    Gene: yecD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37347 (Start-198)
      • engineered (102)
    Domains in SCOPe 2.08: d1j2rd_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2rA (A:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rA (A:)
    mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsa
    dyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrg
    idtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrs
    veeilnal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2rB (B:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rB (B:)
    lnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsadya
    ealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgidt
    ivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsvee
    ilnal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j2rC (C:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rC (C:)
    lelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsad
    yaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgi
    dtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsv
    eeilnal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j2rD (D:)
    mrhdfvfsgvimlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgq
    pvflvrvgwsadyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafyg
    tdlelqlrrrgidtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsin
    hiypriarvrsveeilnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2rD (D:)
    mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsa
    dyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrg
    idtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrs
    veeilnal