PDB entry 1j2o

View 1j2o on RCSB PDB site
Description: Structure of FLIN2, a complex containing the N-terminal LIM domain of LMO2 and ldb1-LID
Class: metal binding protein
Keywords: LIM domain, LIM-interaction-domain (LID), METAL BINDING PROTEIN
Deposited on 2003-01-08, released 2003-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion of Rhombotin-2 and LIM domain-binding protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: LMO2, Ldb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25801 (1-62)
      • cloning artifact (0)
      • linker (63-73)
    • Uniprot P70662 (74-113)
    Domains in SCOPe 2.06: d1j2oa1, d1j2oa2, d1j2oa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j2oA (A:)
gslltcggcqqnigdryflkaidqywhedclscdlcgcrlgevgrrlyyklgrklcrrdy
lrlggsgghmgsggdvmvvgeptlmggefgdederlitrlentqfdaangidde