PDB entry 1j2j

View 1j2j on RCSB PDB site
Description: Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
Class: protein transport
Keywords: protein transport
Deposited on 2003-01-05, released 2003-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BSL7 (2-End)
      • cloning artifact (0-1)
      • engineered (55)
    Domains in SCOPe 2.06: d1j2ja1, d1j2ja2
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j2jb_
  • Heterogens: MG, IOD, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2jA (A:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2jA (A:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2jB (B:)
    nvifedeekskmlarllksshpedlraanklikemvqedqkrmek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2jB (B:)
    ifedeekskmlarllksshpedlraanklikemvqedqkrm