PDB entry 1j2i

View 1j2i on RCSB PDB site
Description: Crystal structure of mouse ARF1 (delta17-Q71L), GTP form
Class: protein transport
Keywords: protein transport
Deposited on 2003-01-05, released 2003-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-05-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAH21403 (2-165)
      • cloning artifact (0-1)
      • engineered (55)
    Domains in SCOPe 2.06: d1j2ia1, d1j2ia2
  • Chain 'B':
    Compound: ADP-ribosylation factor 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAH21403 (2-165)
      • cloning artifact (0-1)
      • engineered (55)
    Domains in SCOPe 2.06: d1j2ib1, d1j2ib2
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2iA (A:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2iB (B:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk