PDB entry 1j2g

View 1j2g on RCSB PDB site
Description: Crystal structure of Urate oxidase from Bacillus SP. TB-90 co-crystallized with 8-Azaxanthine
Deposited on 2003-01-05, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2gA (A:)
    mtkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllt
    sftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeei
    pfettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvs
    gnsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsv
    fhetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprpp
    ygfqcftvtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2gA (A:)
    rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
    nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
    avkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvg
    firdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetet
    lsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcf
    tvtqed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2gB (B:)
    mtkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllt
    sftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeei
    pfettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvs
    gnsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsv
    fhetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprpp
    ygfqcftvtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2gB (B:)
    rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
    nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
    avkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvg
    firdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetet
    lsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcf
    tvtqed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j2gC (C:)
    mtkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllt
    sftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeei
    pfettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvs
    gnsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsv
    fhetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprpp
    ygfqcftvtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2gC (C:)
    rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
    nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
    avkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvg
    firdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetet
    lsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcf
    tvtqed
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j2gD (D:)
    mtkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllt
    sftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeei
    pfettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvs
    gnsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsv
    fhetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprpp
    ygfqcftvtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2gD (D:)
    rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
    nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
    avkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvg
    firdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetet
    lsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcf
    tvtqed