PDB entry 1j2f

View 1j2f on RCSB PDB site
Description: X-ray crystal structure of IRF-3 and its functional implications
Class: DNA binding protein
Keywords: transcription factor, DNA binding protein
Deposited on 2003-01-04, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2fa_
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2fA (A:)
    gamgssldnptpfpnlgpsenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlv
    gsevgdrtlpgwpvtlpdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghc
    htywavseellpnsghgpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvg
    eswpqdqpwtkrlvmvkvvptclralvemarvggasslentvdlhisnshplsltsdqyk
    aylqdlvegmdfqgpges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2fA (A:)
    nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvglpgwpvtlpdpgmsltdrg
    vmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdke
    ggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclralv
    emarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2fB (B:)
    gamgssldnptpfpnlgpsenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlv
    gsevgdrtlpgwpvtlpdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghc
    htywavseellpnsghgpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvg
    eswpqdqpwtkrlvmvkvvptclralvemarvggasslentvdlhisnshplsltsdqyk
    aylqdlvegmdfqgpges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2fB (B:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevtlpgwpvtlpdpgms
    ltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgev
    pkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptc
    lralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq