PDB entry 1j2c

View 1j2c on RCSB PDB site
Description: Crystal structure of rat heme oxygenase-1 in complex with biliverdin IXalpha-iron cluster
Class: oxidoreductase
Keywords: ENZYME-PRODUCT complex, BENT HELIX, OXIDOREDUCTASE
Deposited on 2002-12-29, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heme oxygenase-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j2ca_
  • Heterogens: FE, BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2cA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2cA (A:)
    dsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeie
    rnkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthp
    ellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarm
    ntlemtpevkhrvteeaktafllnielfeelqallt