PDB entry 1j2a

View 1j2a on RCSB PDB site
Description: Structure of E. coli cyclophilin B K163T mutant
Class: isomerase
Keywords: BETA BARREL, isomerase
Deposited on 2002-12-26, released 2004-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin B
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20752 (0-165)
      • engineered (162)
    Domains in SCOPe 2.06: d1j2aa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2aA (A:)
    akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
    teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
    gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsatvlp