PDB entry 1j27

View 1j27 on RCSB PDB site
Description: Crystal structure of a hypothetical protein, TT1725, from Thermus thermophilus HB8 at 1.7A resolution
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein from Thermus thermophilus HB8, MAD, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2002-12-26, released 2003-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein TT1725
  Species: Thermus thermophilus [TaxId:300852]
  Gene: TT1725
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q84BR1 (0-End)
  Domains in SCOPe 2.08: d1j27a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1j27A (A:)
  mkaylglytarletparslkekralikpalerlkarfpvsaarlygldawgyevvgftll
  gndpawveetmraaarflaeaggfqvaleefrleafeldgll
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1j27A (A:)
  mkaylglytarletparslkekralikpalerlkarfpvsaarlygldawgyevvgftll
  gndpawveetmraaarflaeaggfqvaleefrleafel