PDB entry 1j26

View 1j26 on RCSB PDB site
Description: Solution structure of a putative peptidyl-tRNA hydrolase domain in a mouse hypothetical protein
Deposited on 2002-12-25, released 2004-06-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1j26a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j26A (A:)
  gssgssgehakqassyipldrlsisycrssgpggqnvnkvnskaevrfhlasadwieepv
  rqkialthknkinkagelvltsessryqfrnlaeclqkirdmiaeasgpssg