PDB entry 1j26

View 1j26 on RCSB PDB site
Description: Solution structure of a putative peptidyl-tRNA hydrolase domain in a mouse hypothetical protein
Class: Translation
Keywords: peptide chain release factors, RF-1, the GGQ motif, immature colon carcinoma transcript 1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Translation
Deposited on 2002-12-25, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: immature colon carcinoma transcript 1
  Species: Mus musculus [TaxId:10090]
  Gene: NIA Mouse 15K cDNA Clone: H3024H01
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8R035 (7-105)
    • expression tag (0-6)
    • expression tag (106-111)
  Domains in SCOPe 2.08: d1j26a1, d1j26a2, d1j26a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j26A (A:)
  gssgssgehakqassyipldrlsisycrssgpggqnvnkvnskaevrfhlasadwieepv
  rqkialthknkinkagelvltsessryqfrnlaeclqkirdmiaeasgpssg