PDB entry 1j21

View 1j21 on RCSB PDB site
Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with ATP and citrulline
Class: ligase
Keywords: LIGASE, ATP-binding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2002-12-24, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j21a1, d1j21a2
  • Chain 'B':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j21b1, d1j21b2
  • Chain 'C':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j21c1, d1j21c2
  • Chain 'D':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j21d1, d1j21d2
  • Heterogens: ATP, CIR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j21A (A:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j21A (A:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrgydqkd
    aegfikiqalrlrvralver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j21B (B:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j21B (B:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrgydqkd
    aegfikiqalrlrvralver
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j21C (C:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j21C (C:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrgydqkd
    aegfikiqalrlrvralver
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j21D (D:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j21D (D:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrgydqkd
    aegfikiqalrlrvralver