PDB entry 1j1z

View 1j1z on RCSB PDB site
Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with substrate
Class: ligase
Keywords: LIGASE, ATP-binding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2002-12-24, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j1za1, d1j1za2
  • Chain 'B':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j1zb1, d1j1zb2
  • Chain 'C':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j1zc1, d1j1zc2
  • Chain 'D':
    Compound: Argininosuccinate Synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j1zd1, d1j1zd2
  • Heterogens: ATP, CIR, ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1zA (A:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1zA (A:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrqdlvsf
    gydqkdaegfikiqalrlrvralver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1zB (B:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1zB (B:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrqdlvsf
    gydqkdaegfikiqalrlrvralver
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j1zC (C:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1zC (C:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrqdlvsf
    gydqkdaegfikiqalrlrvralver
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j1zD (D:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllh
    isyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallq
    rlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdm
    lspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrq
    dlvsfdeaggydqkdaegfikiqalrlrvralvereghga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1zD (D:)
    mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
    lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
    dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvppysmdanllhisyeg
    gvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavngerlspaallqrlnei
    ggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltldrevlhqrdmlspky
    aelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvgrkapkslyrqdlvsf
    gydqkdaegfikiqalrlrvralver