PDB entry 1j1w

View 1j1w on RCSB PDB site
Description: Crystal Structure Of The Monomeric Isocitrate Dehydrogenase In Complex With NADP+
Class: oxidoreductase
Keywords: Greek key motif, oxidoreductase
Deposited on 2002-12-19, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.26
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1j1wa_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1j1wb_
  • Chain 'C':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1j1wc_
  • Chain 'D':
    Compound: isocitrate dehydrogenase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16100
      • see remark 999 (726)
    Domains in SCOPe 2.07: d1j1wd_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1wA (A:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1wA (A:)
    tpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqki
    sddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekdv
    karydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdfy
    gsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeied
    akkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdlya
    riktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsgk
    mwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeygs
    hdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratnt
    pavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisvt
    gnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrwd
    slgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshfy
    lalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntdl
    tskamrpsatfnaalapl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1wB (B:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1wB (B:)
    tpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqki
    sddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekdv
    karydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdfy
    gsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeied
    akkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdlya
    riktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsgk
    mwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeygs
    hdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratnt
    pavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisvt
    gnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrwd
    slgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshfy
    lalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntdl
    tskamrpsatfnaalapl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j1wC (C:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1wC (C:)
    tpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqki
    sddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekdv
    karydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdfy
    gsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeied
    akkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdlya
    riktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsgk
    mwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeygs
    hdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratnt
    pavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisvt
    gnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrwd
    slgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshfy
    lalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntdl
    tskamrpsatfnaalapl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j1wD (D:)
    mstpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtq
    kisddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtek
    dvkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngd
    fygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaei
    edakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdl
    yariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirds
    gkmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeey
    gshdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnrarat
    ntpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtis
    vtgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylr
    wdslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgsh
    fylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpnt
    dltskamrpsatfnaalapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1wD (D:)
    tpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqki
    sddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekdv
    karydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdfy
    gsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeied
    akkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdlya
    riktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsgk
    mwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeygs
    hdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratnt
    pavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisvt
    gnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrwd
    slgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshfy
    lalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntdl
    tskamrpsatfnaalapl