PDB entry 1j1v

View 1j1v on RCSB PDB site
Description: Crystal structure of DnaA domainIV complexed with DnaAbox DNA
Class: replication/DNA
Keywords: Protein-DNA complex, Replication, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, replication/DNA COMPLEX
Deposited on 2002-12-18, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosomal replication initiator protein dnaA
    Species: Escherichia coli [TaxId:562]
    Gene: dnaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03004 (0-93)
      • modified residue (35)
      • modified residue (37)
    Domains in SCOPe 2.06: d1j1va_
  • Chain 'B':
    Compound: 5'-d(*tp*gp*tp*tp*ap*tp*cp*cp*ap*cp*ap*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*cp*tp*gp*tp*gp*gp*ap*tp*ap*ap*cp*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j1vA (A:)
    vtidniqktvaeyykikvadllskrrsrsvarprqmamalakeltnhslpeigdafggrd
    httvlhacrkieqlreeshdikedfsnlirtlss
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.