PDB entry 1j1v

View 1j1v on RCSB PDB site
Description: Crystal structure of DnaA domainIV complexed with DnaAbox DNA
Class: replication/DNA
Keywords: Protein-DNA complex, Replication, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, replication/DNA COMPLEX
Deposited on 2002-12-18, released 2003-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chromosomal replication initiator protein dnaA
  Species: Escherichia coli [TaxId:562]
  Gene: dnaA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03004 (0-93)
    • modified residue (35)
    • modified residue (37)
  Domains in SCOPe 2.08: d1j1va_
• Chain 'B':
  Compound: 5'-d(*tp*gp*tp*tp*ap*tp*cp*cp*ap*cp*ap*gp*g)-3'
  
• Chain 'C':
  Compound: 5'-d(*cp*cp*tp*gp*tp*gp*gp*ap*tp*ap*ap*cp*a)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j1vA (A:)
  vtidniqktvaeyykikvadllskrrsrsvarprqmamalakeltnhslpeigdafggrd
  httvlhacrkieqlreeshdikedfsnlirtlss
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.