PDB entry 1j1t

View 1j1t on RCSB PDB site
Description: Alginate lyase from Alteromonas sp.272
Class: lyase
Keywords: alginate lyase, alteromonas, guluronate, mannuronate, lyase
Deposited on 2002-12-14, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Alteromonas sp. [TaxId:262966]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j1ta_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1tA (A:)
    dnsngstipssitsgsifdlegdnpnplvddstlvfvpleaqhitpngngwrheykvkes
    lrvamtqtyevfeatvkvemsdggktiisqhhasdtgtiskvyvsdtdesgfndsvanng
    ifdvyvrlrntsgneekfalgtmtsgetfnlrvvnnygdvevtafgnsfgipveddsqsy
    fkfgnylqsqdpytldkcgeagnsnsfkncfedlgiteskvtmtnvtytretn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1tA (A:)
    stipssitsgsifdlegdnpnplvddstlvfvpleaqhitpngngwrheykvkeslrvam
    tqtyevfeatvkvemsdggktiisqhhasdtgtiskvyvsdtdesgfndsvanngifdvy
    vrlrntsgneekfalgtmtsgetfnlrvvnnygdvevtafgnsfgipveddsqsyfkfgn
    ylqsqdpytldkcgeagnsnsfkncfedlgiteskvtmtnvtytretn